Iright
BRAND / VENDOR: Proteintech

Proteintech, 33770-1-AP, ZNF688 Polyclonal antibody

CATALOG NUMBER: 33770-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF688 (33770-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF688 in WB, IP, ELISA applications with reactivity to human samples 33770-1-AP targets ZNF688 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-673 cells, SK-N-SH cells Positive IP detected in: A-673 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZNF688 encodes a C2H2-type zinc finger transcription factor that likely regulates gene expression and chromatin structure in a nucleus-localized manner. Though functionally understudied, it is predicted to act as a context-dependent transcriptional modulator influencing cell differentiation, stress responses, and tumor-associated transcriptional remodeling. Emerging transcriptomic evidence implicates ZNF688 in epigenetic control and cancer-related gene regulation, aligning it with broader zinc finger-mediated regulatory networks. (PMID: 30041579) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37821 Product name: Recombinant human ZNF688 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 94-276 aa of BC018997 Sequence: KGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG Predict reactive species Full Name: zinc finger protein 688 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC018997 Gene Symbol: ZNF688 Gene ID (NCBI): 146542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0C7X2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924