Iright
BRAND / VENDOR: Proteintech

Proteintech, 33811-1-AP, TRMT1L/C1orf25 Polyclonal antibody

CATALOG NUMBER: 33811-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRMT1L/C1orf25 (33811-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT1L/C1orf25 in WB, ELISA applications with reactivity to human, mouse, rat samples 33811-1-AP targets TRMT1L/C1orf25 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TRMT1L (tRNA methyltransferase 1-like), formerly known as C1orf25, is a vertebrate paralog of the evolutionarily conserved TRMT1 (tRNA methyltransferase 1). Knockout of TRMT1L in mice resulted in significant motor coordination impairment and abnormal exploratory behavior, indicating that its activity is also related to neural function (PMID: 17198746). Human TRMT1L catalyzes m2 and 2G in tyrosine tRNAs and simultaneously regulates acp3U in tRNAs (PMID: 39786990). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36582 Product name: Recombinant human C1orf25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 570-733 aa of BC045535 Sequence: TPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRRW Predict reactive species Full Name: chromosome 1 open reading frame 25 Observed Molecular Weight: 81 kDa GenBank Accession Number: BC045535 Gene Symbol: C1orf25 Gene ID (NCBI): 81627 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z2T5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924