Proteintech, 33911-1-AP, DQX1 Polyclonal antibody

Size: 20ul / 150ul The DQX1 (33911-1-AP) by Proteintech is a Polyclonal antibody targeting DQX1 in WB, ELISA applications with reactivity to human samples 33911-1-AP targets DQX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DQX1, also known as DEAQ-box RNA helicase 1, is a member of the Asp-Glu-Ala-Asp (DEAD)-box family of RNA helicases, specifically falling into the DEAQ subfamily based on its unique variant motif sequence. These proteins are characterized by conserved motifs involved in ATP binding, hydrolysis, and RNA unwinding/remodeling, playing crucial roles in virtually all aspects of RNA metabolism. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40792 Product name: Recombinant human DQX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 62-161 aa of BC075018 Sequence: DSLQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE Predict reactive species Full Name: DEAQ box RNA-dependent ATPase 1 Calculated Molecular Weight: 599 aa, 67 kDa Observed Molecular Weight: 79 kDa GenBank Accession Number: BC075018 Gene Symbol: DQX1 Gene ID (NCBI): 165545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TE96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.