Iright
BRAND / VENDOR: Proteintech

Proteintech, 33913-1-AP, BLOC1S1 Polyclonal antibody

CATALOG NUMBER: 33913-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BLOC1S1 (33913-1-AP) by Proteintech is a Polyclonal antibody targeting BLOC1S1 in WB, ELISA applications with reactivity to human, mouse, rat samples 33913-1-AP targets BLOC1S1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: EC109 cells, HEK-293 cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information BLOC1S1, also named as BLOS1, GCN5L1 and RT14, belongs to the BLOC1S1 family. BLOC1S1 may be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35143 Product name: Recombinant human BLOC1S1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC132795 Sequence: MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS Predict reactive species Full Name: biogenesis of lysosomal organelles complex-1, subunit 1 Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC132795 Gene Symbol: BLOC1S1 Gene ID (NCBI): 2647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78537 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924