Iright
BRAND / VENDOR: Proteintech

Proteintech, 33922-1-AP, DPH5 Polyclonal antibody

CATALOG NUMBER: 33922-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DPH5 (33922-1-AP) by Proteintech is a Polyclonal antibody targeting DPH5 in WB, ELISA applications with reactivity to human samples 33922-1-AP targets DPH5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-204 cells, HL-60 cells, Raji cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The research background of DPH5 mainly revolves around its key role in diphthamide amide biosynthesis pathway. Diphtheria amide is a highly conserved post-translational modification of eukaryotic translation elongation factor eEF2, which is very important for maintaining translation accuracy and protein synthesis efficiency. Due to modification, the molecular weight is 26-36 kDa. There are also some isoform and ubiquitination modifications. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38953 Product name: Recombinant human DPH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-285 aa of NM_001077394.1 Sequence: WRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL Predict reactive species Full Name: DPH5 homolog (S. cerevisiae) Calculated Molecular Weight: 32kDa,285aa Observed Molecular Weight: 26-36 kDa GenBank Accession Number: NM_001077394.1 Gene Symbol: DPH5 Gene ID (NCBI): 51611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H2P9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924