Iright
BRAND / VENDOR: Proteintech

Proteintech, 33961-1-AP, MVB12B Polyclonal antibody

CATALOG NUMBER: 33961-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MVB12B (33961-1-AP) by Proteintech is a Polyclonal antibody targeting MVB12B in WB, ELISA applications with reactivity to human samples 33961-1-AP targets MVB12B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information FAM125B/MVB12B gene codes for a component of a membrane complex involved in vesicular trafficking process, a function similar to that of the Caveolin genes (CAV1 and CAV2) which have previously been associated with primary open-angle glaucoma (PMID: 24518671). MVB12b is also a target for TANK-binding kinase 1 phosphorylation, which is essential for the sorting of DNA into EVs and stimulation of bystander cells (PMID: 30804548). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40577 Product name: Recombinant human FAM125B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-200 aa of BC000122 Sequence: TMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDS Predict reactive species Full Name: family with sequence similarity 125, member B Calculated Molecular Weight: 319 aa, 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC000122 Gene Symbol: FAM125B Gene ID (NCBI): 89853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H7P6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924