Iright
BRAND / VENDOR: Proteintech

Proteintech, 33966-1-AP, LSM14A Polyclonal antibody

CATALOG NUMBER: 33966-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LSM14A (33966-1-AP) by Proteintech is a Polyclonal antibody targeting LSM14A in WB, IF/ICC, ELISA applications with reactivity to human samples 33966-1-AP targets LSM14A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, HepG2 cells, L02 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LSm14A was originally discovered to be a component of the P-bodies, it is a member of the LSm family of proteins, which have been shown to be involved in RNA processing events. The N terminus of LSm14A is a conserved LSm domain, whereas the C terminus contains two domains called "DFDF box" and "FDF_TFG box", respectively. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag41250 Product name: Recombinant human LSM14A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-219 aa of BC016842 Sequence: MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS Predict reactive species Full Name: LSM14A, SCD6 homolog A (S. cerevisiae) Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC016842 Gene Symbol: LSM14A Gene ID (NCBI): 26065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8ND56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924