Proteintech, 33972-1-AP, FHOD1 Polyclonal antibody

Size: 20ul / 150ul The FHOD1 (33972-1-AP) by Proteintech is a Polyclonal antibody targeting FHOD1 in WB, ELISA applications with reactivity to human samples 33972-1-AP targets FHOD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FHOD1 (Formin homology 2 domain-containing protein 1) is a member of the Diaphanous-related formins (DRFs), a family of proteins characterized by the presence of a GTP-binding domain (GBD), formin homology (FH) 1 and FH2 domains, a coiled-coil motif, and a diaphanous autoregulatory domain (DAD). Accumulating evidence indicates that FHOD1 not only modulates intracellular signaling pathways in tumor cells but also influences multiple components of the tumor microenvironment (TME), including T cells, B cells, cancer-associated fibroblasts (CAFs), and various cytokines. Dysregulated expression and functional impairment of FHOD1 have been implicated in the development of tumor immunosuppression. Specifically, FHOD1 interferes with the function of chemokine receptors responsible for guiding immune cell trafficking to tumor sites, thereby compromising the efficient infiltration of immune cells into the TME. This deficiency limits the capacity of immune cells to target and eliminate tumor cells. Furthermore, FHOD1 aberrantly activates intracellular signaling pathways within immune cells, impairing their ability to recognize and respond to tumor cells effectively. Consequently, FHOD1 contributes to an immunosuppressive TME, creating a permissive environment for tumor progression and metastasis (PMID: 40364836). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38590 Product name: Recombinant human FHOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_013241.2 Sequence: MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDK Predict reactive species Full Name: formin homology 2 domain containing 1 Calculated Molecular Weight: 127kDa，1164aa Observed Molecular Weight: 125 kDa GenBank Accession Number: NM_013241.2 Gene Symbol: FHOD1 Gene ID (NCBI): 29109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.