Proteintech, 33973-1-AP, HICE1 Polyclonal antibody

Size: 20ul / 150ul The HICE1 (33973-1-AP) by Proteintech is a Polyclonal antibody targeting HICE1 in WB, ELISA applications with reactivity to human samples 33973-1-AP targets HICE1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MG-63 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40571 Product name: Recombinant human HICE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-284 aa of BC010176 Sequence: DVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS Predict reactive species Full Name: HEC1/NDC80 interacting, centrosome associated 1 Calculated Molecular Weight: 410 aa, 45 kDa Observed Molecular Weight: 38kDa, 45kDa GenBank Accession Number: BC010176 Gene Symbol: HICE1 Gene ID (NCBI): 93323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BT25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.