Product Description
Size: 20ul / 150ul
The HICE1 (33973-1-AP) by Proteintech is a Polyclonal antibody targeting HICE1 in WB, ELISA applications with reactivity to human samples
33973-1-AP targets HICE1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, MG-63 cells, U2OS cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag40571 Product name: Recombinant human HICE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-284 aa of BC010176 Sequence: DVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS Predict reactive species
Full Name: HEC1/NDC80 interacting, centrosome associated 1
Calculated Molecular Weight: 410 aa, 45 kDa
Observed Molecular Weight: 38kDa, 45kDa
GenBank Accession Number: BC010176
Gene Symbol: HICE1
Gene ID (NCBI): 93323
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9BT25
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924