Iright
BRAND / VENDOR: Proteintech

Proteintech, 34030-1-AP, ST6GAL1 Polyclonal antibody

CATALOG NUMBER: 34030-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ST6GAL1 (34030-1-AP) by Proteintech is a Polyclonal antibody targeting ST6GAL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 34030-1-AP targets ST6GAL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, mouse kindey tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg5252 Product name: Recombinant rat ST6GAL1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-403 aa of NM_001113344.1 Sequence: KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC Predict reactive species Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 43-45 kDa, 50-70 kDa GenBank Accession Number: NM_001113344.1 Gene Symbol: ST6GAL1 Gene ID (NCBI): 25197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P13721-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924