Proteintech, 34060-1-AP, C1orf55 Polyclonal antibody

Size: 20ul / 150ul The C1orf55 (34060-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf55 in WB, ELISA applications with reactivity to human samples 34060-1-AP targets C1orf55 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, THP-1 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information C1orf55, also known as Nurit, is a relatively small, conserved vertebrate-specific protein that localizes to the nucleus, particularly within the nucleolus. Its precise molecular function is an active area of research, but it is implicated in fundamental cellular processes related to ribosome biogenesis, cell proliferation, and the DNA damage response. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag41112 Product name: Recombinant human C1orf55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-451 aa of BC071563 Sequence: DGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK Predict reactive species Full Name: chromosome 1 open reading frame 55 Observed Molecular Weight: 50 kDa GenBank Accession Number: BC071563 Gene Symbol: C1orf55 Gene ID (NCBI): 163859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6IQ49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.