Proteintech, 34075-1-AP, AP5Z1/SPG48 Polyclonal antibody

Size: 20ul / 150ul The AP5Z1/SPG48 (34075-1-AP) by Proteintech is a Polyclonal antibody targeting AP5Z1/SPG48 in WB, IP, ELISA applications with reactivity to human samples 34075-1-AP targets AP5Z1/SPG48 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MG-63 cells, U2OS cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information AP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26954 Product name: Recombinant human KIAA0415 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 260-364 aa of BC037399 Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV Predict reactive species Full Name: KIAA0415 Calculated Molecular Weight: 807 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC037399 Gene Symbol: AP5Z1/SPG48 Gene ID (NCBI): 9907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43299 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.