Proteintech, 51026-2-AP, Prnd Polyclonal antibody

Size: 20ul / 150ul The Prnd (51026-2-AP) by Proteintech is a Polyclonal antibody targeting Prnd in WB, ELISA applications with reactivity to human, mouse samples 51026-2-AP targets Prnd in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0731 Product name: Recombinant mouse Prnd protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-154 aa of BC025140 Sequence: RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLER Predict reactive species Full Name: prion protein dublet Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC025140 Gene Symbol: Prnd Gene ID (NCBI): 26434 RRID: AB_615020 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9QUG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.