Iright
BRAND / VENDOR: Proteintech

Proteintech, 51042-1-AP, DDX4/VASA Polyclonal antibody

CATALOG NUMBER: 51042-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX4/VASA (51042-1-AP) by Proteintech is a Polyclonal antibody targeting DDX4/VASA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 51042-1-AP targets DDX4/VASA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information DEAD box proteins are characterized by nine conserved sequence motifs located on two functional domains. Domain I contains six of these motifs, including the Q motif and the Walker A motif, motifs Ia and Ib, the Walker B motif, and motif III, which may act to link ATPase and helicase activities of the protein [PMID:21653890]. DDX4, a member of the DEAD box family of ATP-dependent RNA helicases, plays a central role in several aspects of germ cell development. Its function is not only required during gametogenesis in the adult but is also essential for the specification of the germ cell lineage during embryogenesis [PMID:20016130]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0447 Product name: Recombinant human DDX4,VASA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-163 aa of BC047455 Sequence: NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGDNDLDPDECMQRTGGLFGSRRPVLSGTGNGDT Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 Calculated Molecular Weight: 690aa,76 kDa; 724aa,79 kDa Observed Molecular Weight: 79 kDa GenBank Accession Number: BC047455 Gene Symbol: DDX4 Gene ID (NCBI): 54514 RRID: AB_2092998 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924