Iright
BRAND / VENDOR: Proteintech

Proteintech, 51097-1-AP, CYP302a1 (mosquito) Polyclonal antibody

CATALOG NUMBER: 51097-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYP302a1 (mosquito) (51097-1-AP) by Proteintech is a Polyclonal antibody targeting CYP302a1 (mosquito) in ELISA applications with reactivity to mosquito samples 51097-1-AP targets CYP302a1 (mosquito) in ELISA applications and shows reactivity with mosquito samples. Background Information CYP302a1, also named as disembodied (dib-Bm), belongs to the cytochrome P450 family. This antibody detects the CYP302a1 protein of mosquito. Specification Tested Reactivity: mosquito Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0761 Product name: Recombinant CYP302a1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-515 aa of AY947549 Sequence: MYLSPVKSKIKSATLMTSRSCATVVLENVKPYNQIPGPRGPFGLGNLYQYIPGIGKYSFDALHESGQDKYEKYGPIVRETMVPGQDIVWLYDPNDIAAVLNDKTPGIYPSRRSHTALAKYRRDRPNVYRTAGLLATNGIEWWKIRSELQKGLSSPQSVRNFLPLTDKVTREFVASMNSTEHDCVPDFMPAISRLNLELICVMAFDVRLDSFSDEQMKPNSLSSRLMESAEVTNQSILPTDQGFQLWKYFETPAYRKLRKAQEFMEKTAVELVSQKLLYFDEDQQKLASGRHRSRSLLEEYLRNPNLELHDIIGMAADLLLAGVHTSSYTTAFALYHLCLNPDAQDKLYQEACRILPDPWECQIEAAALNSEASYCRAVLKESLRLNPISIGVGRILNKDATLGGYHVPKGTVVVTQNLVSCRQERYFKNPTKFIPERWMRETKEDVNPYLVLPFGHGMRSCIARRMAEQNMLVLLLRLIRSYEIDWKGKVPMNIETKLINQPDQPIKIAFRSRKS Predict reactive species Full Name: CYP302a1 (mosquito) Calculated Molecular Weight: 59 kDa GenBank Accession Number: AY947549 RRID: AB_2881247 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924