Iright
BRAND / VENDOR: Proteintech

Proteintech, 51123-1-AP, PLTP Polyclonal antibody

CATALOG NUMBER: 51123-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLTP (51123-1-AP) by Proteintech is a Polyclonal antibody targeting PLTP in WB, ELISA applications with reactivity to human samples 51123-1-AP targets PLTP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PLTP (phospholipid transfer protein) belongs to the family of lipid-binding and lipid-transfer proteins. PLTP is involved in the distribution and metabolism of high density lipoprotein ( HDL ) and reverse cholesterol transfer ( RCT ). In plasma, PLTP catalyzes the transfer of phospholipids ( mainly phosphatidylcholine ) between lipoproteins (PMID: 29558025). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0681 Product name: Recombinant human PLTP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC019898 Sequence: MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD Predict reactive species Full Name: phospholipid transfer protein Calculated Molecular Weight: 54.7 kDa, 81 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC019898 Gene Symbol: PLTP Gene ID (NCBI): 5360 RRID: AB_3670234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55058 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924