Proteintech, 51141-1-AP, iASPP Polyclonal antibody

Size: 20ul / 150ul The PPP1R13L (51141-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R13L in WB, IHC, ELISA applications with reactivity to human, mouse samples 51141-1-AP targets PPP1R13L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, HEK-293 cells, mouse testis tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0635 Product name: Recombinant human PPP1R13L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC032298 Sequence: MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGRAGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 13 like Calculated Molecular Weight: 45 kDa, 89 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC032298 Gene Symbol: PPP1R13L Gene ID (NCBI): 10848 RRID: AB_2268619 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.