Proteintech, 51157-1-AP, Cyp4a12a Polyclonal antibody

Size: 20ul / 150ul The Cyp4a12a (51157-1-AP) by Proteintech is a Polyclonal antibody targeting Cyp4a12a in WB, IHC, ELISA applications with reactivity to mouse, rat, human samples 51157-1-AP targets Cyp4a12a in WB, IHC, ELISA applications and shows reactivity with mouse, rat, human samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. Mouse Cyp4a12a oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. For modification, the MW of Cyp4a12a is about 58-70 kDa in western blot detection. Specification Tested Reactivity: mouse, rat, human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0509 Product name: Recombinant mouse Cyp4a12a protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 248-508 aa of NM_177406 Sequence: CKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ Predict reactive species Full Name: cytochrome P450, family 4, subfamily a, polypeptide 12a Observed Molecular Weight: 58-70 kDa GenBank Accession Number: NM_177406 Gene Symbol: Cyp4a12a Gene ID (NCBI): 277753 RRID: AB_2881255 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q91WL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.