Iright
BRAND / VENDOR: Proteintech

Proteintech, 60029-1-Ig, KMO Monoclonal antibody

CATALOG NUMBER: 60029-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KMO (60029-1-Ig) by Proteintech is a Monoclonal antibody targeting KMO in WB, ELISA applications with reactivity to human samples 60029-1-Ig targets KMO in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information KMO(Kynurenine 3-monooxygenase) is a membrane protein located on the outer membrane of mitochondria. Tissue distribution studies have revealed that, in rats, highest enzyme activity is found in kidney and liver, with brain having the least activity in comparison to peripheral organs(PMID: 9237672). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1109 Product name: Recombinant human KMO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-407 aa of BC005297 Sequence: LSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKR Predict reactive species Full Name: kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) Calculated Molecular Weight: 486 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC005297 Gene Symbol: KMO Gene ID (NCBI): 8564 RRID: AB_2133396 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15229 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924