Proteintech, 60066-1-Ig, LGALS3BP Monoclonal antibody

Size: 20ul / 150ul The LGALS3BP (60066-1-Ig) by Proteintech is a Monoclonal antibody targeting LGALS3BP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 60066-1-Ig targets LGALS3BP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue Positive IP detected in: human plasma tissue Positive IHC detected in: human breast cancer tissue, human oesophagus cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ). LGALS3BP has a predicted mass of ∼65 kDa. It is heavily glycosylated and shows an apparent molecular weight of 90 kDa on SDS-PAGE. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0294 Product name: Recombinant human LGALS3BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-221 aa of BC002403 Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL Predict reactive species Full Name: lectin, galactoside-binding, soluble, 3 binding protein Calculated Molecular Weight: 585 aa, 65 kDa Observed Molecular Weight: 65-90 kDa GenBank Accession Number: BC002403 Gene Symbol: LGALS3BP Gene ID (NCBI): 3959 RRID: AB_2265800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.