Iright
BRAND / VENDOR: Proteintech

Proteintech, 60069-1-Ig, ERAB Monoclonal antibody

CATALOG NUMBER: 60069-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERAB (60069-1-Ig) by Proteintech is a Monoclonal antibody targeting ERAB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 60069-1-Ig targets ERAB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: ROS1728 cells, RAW 264.7 cells, Jurkat cells, HEK-293 cells, HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1020 Product name: Recombinant human HSD17B10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-252 aa of BC008708 Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 10 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC008708 Gene Symbol: ERAB Gene ID (NCBI): 3028 RRID: AB_2119779 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q99714 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924