Iright
BRAND / VENDOR: Proteintech

Proteintech, 60092-1-Ig, Prohibitin Monoclonal antibody

CATALOG NUMBER: 60092-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Prohibitin (60092-1-Ig) by Proteintech is a Monoclonal antibody targeting Prohibitin in WB, IHC, ELISA applications with reactivity to human, rat, pig samples 60092-1-Ig targets Prohibitin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: human heart tissue, HeLa cells, human placenta tissue, pig heart tissue, rat heart tissue Positive IHC detected in: human liver tissue, human kidney tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Prohibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549). Specification Tested Reactivity: human, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species Full Name: prohibitin Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC013401 Gene Symbol: Prohibitin Gene ID (NCBI): 5245 RRID: AB_2252403 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924