Proteintech, 60130-1-Ig, Gastrokine 1 Monoclonal antibody

Size: 20ul / 150ul The Gastrokine 1 (60130-1-Ig) by Proteintech is a Monoclonal antibody targeting Gastrokine 1 in WB, IHC, IF-P, ELISA applications with reactivity to human, rat, pig, mouse samples 60130-1-Ig targets Gastrokine 1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig, mouse samples. Tested Applications Positive WB detected in: human stomach tissue, rat stomach tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human stomach tissue, mouse stomach tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor. Specification Tested Reactivity: human, rat, pig, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6091 Product name: Recombinant human GKN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-196 aa of BC059778 Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN Predict reactive species Full Name: gastrokine 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC059778 Gene Symbol: Gastrokine 1 Gene ID (NCBI): 56287 RRID: AB_2111459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NS71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.