Proteintech, 60161-2-Ig, MSH2 Monoclonal antibody

Size: 20ul / 150ul The MSH2 (60161-2-Ig) by Proteintech is a Monoclonal antibody targeting MSH2 in WB, IHC, ELISA applications with reactivity to human samples 60161-2-Ig targets MSH2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-468 cells, Saos-2 cells, COLO 320 cells, A431 cells, HuT 78 cells, MOLT-4 cells, K-562 cells Positive IHC detected in: Ramos cells, human appendicitis tissue, human rectal cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7835 Product name: Recombinant human MSH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 585-934 aa of BC021566 Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT Predict reactive species Full Name: mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC021566 Gene Symbol: MSH2 Gene ID (NCBI): 4436 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.