Iright
BRAND / VENDOR: Proteintech

Proteintech, 60193-1-Ig, PPARD Monoclonal antibody

CATALOG NUMBER: 60193-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPARD (60193-1-Ig) by Proteintech is a Monoclonal antibody targeting PPARD in WB, ELISA applications with reactivity to human, pig samples 60193-1-Ig targets PPARD in WB, IHC, ChIP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, pig adipose tissue, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Peroxisome proliferator-activator receptor delta(PPARD), a ligand-activated transcription factor, belongs to the PPARs family, which get its name for their chemicals that induce proliferation of peroxisomes, organelles that contributes to the oxidation of fatty acids. PPARD is a receptor for peroxisome proliferator and once activated by a ligand, it binds to and activates the promoter elements of target genes, such as acylCoA oxidase gene. But it act as a repressor for the NPC1L1 gene. Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16770 Product name: Recombinant human PPARD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-361 aa of BC002715 Sequence: IRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE Predict reactive species Full Name: peroxisome proliferator-activated receptor delta Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC002715 Gene Symbol: PPARD Gene ID (NCBI): 5467 RRID: AB_10896827 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924