Proteintech, 60194-1-Ig, CD3 Delta Monoclonal antibody

Size: 20ul / 150ul The CD3 Delta (60194-1-Ig) by Proteintech is a Monoclonal antibody targeting CD3 Delta in WB, ELISA applications with reactivity to human, mouse samples 60194-1-Ig targets CD3 Delta in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10207 Product name: Recombinant human CD3D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-171 aa of BC070321 Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK Predict reactive species Full Name: CD3d molecule, delta (CD3-TCR complex) Calculated Molecular Weight: 171 aa, 19 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC070321 Gene Symbol: CD3 Delta Gene ID (NCBI): 915 RRID: AB_10898175 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.