Proteintech, 60195-1-Ig, TMEM70 Monoclonal antibody

Size: 20ul / 150ul The TMEM70 (60195-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM70 in WB, IHC, ELISA applications with reactivity to human samples 60195-1-Ig targets TMEM70 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells Positive IHC detected in: human liver tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16947 Product name: Recombinant human TMEM70 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species Full Name: transmembrane protein 70 Calculated Molecular Weight: 260 aa, 29 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC002748 Gene Symbol: TMEM70 Gene ID (NCBI): 54968 RRID: AB_10896316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BUB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.