Iright
BRAND / VENDOR: Proteintech

Proteintech, 60196-1-Ig, Fas/CD95 Monoclonal antibody

CATALOG NUMBER: 60196-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Fas/CD95 (60196-1-Ig) by Proteintech is a Monoclonal antibody targeting Fas/CD95 in WB, IHC, ELISA applications with reactivity to human samples 60196-1-Ig targets Fas/CD95 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, K-562 cells, U-937 cells Positive IHC detected in: human tonsillitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). This anti-Fas monoclonal antibody can be used to induce apoptosis in cell cultures through Fas by imitating the Fas-ligand. Specification Tested Reactivity: human Cited Reactivity: human, zebrafish Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3718 Product name: Recombinant human FAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-335 aa of BC012479 Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Predict reactive species Full Name: Fas (TNF receptor superfamily, member 6) Calculated Molecular Weight: 35-38 kDa Observed Molecular Weight: 38-45 kDa GenBank Accession Number: BC012479 Gene Symbol: Fas/CD95 Gene ID (NCBI): 355 RRID: AB_10892669 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P25445 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924