Proteintech, 60208-2-Ig, CD23 Monoclonal antibody

Size: 20ul / 150ul The CD23 (60208-2-Ig) by Proteintech is a Monoclonal antibody targeting CD23 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 60208-2-Ig targets CD23 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human tonsillitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0425 Product name: Recombinant human CD23,FCER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-248 aa of BC064417 Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG Predict reactive species Full Name: Fc fragment of IgE, low affinity II, receptor for (CD23) Calculated Molecular Weight: 321 aa, 36 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC064417 Gene Symbol: CD23 Gene ID (NCBI): 2208 RRID: AB_11232221 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.