Proteintech, 60209-2-Ig, CD7 Monoclonal antibody

Size: 20ul / 150ul The CD7 (60209-2-Ig) by Proteintech is a Monoclonal antibody targeting CD7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 60209-2-Ig targets CD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, HuH-7 cells, MOLT-4 cells Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, mouse thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512). Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1805 Product name: Recombinant human CD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC009293 Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ Predict reactive species Full Name: CD7 molecule Calculated Molecular Weight: 240 aa, 25 kDa Observed Molecular Weight: 34-36 kDa GenBank Accession Number: BC009293 Gene Symbol: CD7 Gene ID (NCBI): 924 ENSEMBL Gene ID: ENSG00000173762 RRID: AB_2881355 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09564 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.