Proteintech, 60232-1-Ig, CD9 Monoclonal antibody

Size: 20ul / 150ul The CD9 (60232-1-Ig) by Proteintech is a Monoclonal antibody targeting CD9 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 60232-1-Ig targets CD9 in WB, IHC, IF/ICC, IF-P, ELISA, PLA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human colon cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue, human ovary tumor tissue, human lung cancer tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site. Specification Tested Reactivity: human Cited Reactivity: human, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14529 Product name: Recombinant human CD9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species Full Name: CD9 molecule Calculated Molecular Weight: 228 aa, 25 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC011988 Gene Symbol: CD9 Gene ID (NCBI): 928 RRID: AB_11232215 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.