Proteintech, 60239-1-Ig, Desmocollin 2 Monoclonal antibody

Size: 20ul / 150ul The Desmocollin 2 (60239-1-Ig) by Proteintech is a Monoclonal antibody targeting Desmocollin 2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 60239-1-Ig targets Desmocollin 2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Raji cells Positive IF-P detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelia and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5450 Product name: Recombinant human DSC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species Full Name: desmocollin 2 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC063291 Gene Symbol: Desmocollin 2 Gene ID (NCBI): 1824 RRID: AB_2881362 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.