Proteintech, 60249-1-Ig, PGRMC2 Monoclonal antibody

Size: 20ul / 150ul The PGRMC2 (60249-1-Ig) by Proteintech is a Monoclonal antibody targeting PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples 60249-1-Ig targets PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells, HepG2 cells, pig liver tissue Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human cervical cancer tissue Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494). Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species Full Name: progesterone receptor membrane component 2 Calculated Molecular Weight: 223 aa, 24 kDa Observed Molecular Weight: 24 kDa, 28 kDa GenBank Accession Number: BC016692 Gene Symbol: PGRMC2 Gene ID (NCBI): 10424 RRID: AB_2881370 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15173 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.