Iright
BRAND / VENDOR: Proteintech

Proteintech, 60258-1-Ig, CD11c Monoclonal antibody

CATALOG NUMBER: 60258-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD11c (60258-1-Ig) by Proteintech is a Monoclonal antibody targeting CD11c in WB, IHC, IF-P, ELISA applications with reactivity to human samples 60258-1-Ig targets CD11c in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human spleen tissue, THP-1 cells, HL-60 cells, U-937 cells Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue, human breast cancer tissue, human liver cancer tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, human appendicitis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis. Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11350 Product name: Recombinant human CD11c/Integrin alpha X protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-352 aa of BC038237 Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA Predict reactive species Full Name: integrin, alpha X (complement component 3 receptor 4 subunit) Calculated Molecular Weight: 1169 aa, 129 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC038237 Gene Symbol: CD11c Gene ID (NCBI): 3687 ENSEMBL Gene ID: ENSG00000140678 RRID: AB_2881379 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924