Iright
BRAND / VENDOR: Proteintech

Proteintech, 60278-1-Ig, IL-19 Monoclonal antibody

CATALOG NUMBER: 60278-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-19 (60278-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-19 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 60278-1-Ig targets IL-19 in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: U-937 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IL-19, a member of the IL-10 cytokine family, is expressed in epithelial cells, endothelial cells, and macrophages. It can bind the interleukin-20 receptor complex IL-20R1/IL-20R2 and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). IL-19 induces IL-6 and TNF-alpha production in monocytes. It also induces cell apoptosis and reactive oxygen species production in monocytes, which suggests a role of this cytokine in inflammatory responses. It is up-regulated in monocytes following stimulation with lipopolysaccharide (LPS), and granulocyte-macrophage colony-stimulating factor (GM-CSF). IL-19 alters the balance of Th1 and Th2 cells in favor of Th2 cells. IL-19 contributes to a range of diseases and disorders, such as breast cancer, squamous cell carcinoma of the skin, asthma, endotoxic shock, uremia, psoriasis, rheumatoid arthritis, and periodontal and vascular disease. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18887 Product name: Recombinant human IL-19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 63-215 aa of BC153127 Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA Predict reactive species Full Name: interleukin 19 Calculated Molecular Weight: 177 aa, 20 kDa GenBank Accession Number: BC153127 Gene Symbol: IL-19 Gene ID (NCBI): 29949 RRID: AB_2881397 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UHD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924