Proteintech, 60311-1-Ig, HER2/ErbB2 Monoclonal antibody

Size: 20ul / 150ul The HER2/ErbB2 (60311-1-Ig) by Proteintech is a Monoclonal antibody targeting HER2/ErbB2 in IHC, IF-P, ELISA applications with reactivity to human samples 60311-1-Ig targets HER2/ErbB2 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive FC detected in: SK-BR-3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:800-1:3200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information HER2, ErbB2, and Neu is a 185-kDa transmembrane glycoprotein member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. It has no ligand-binding domain and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Amplification and/or overexpression of HER2 have been reported in numerous cancers, including breast and ovarian tumors. HER2 is a therapeutic target for the treatment of breast cancer and other carcinomas. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16463 Product name: Recombinant human ERBB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-372 aa of BC156755 Sequence: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG Predict reactive species Full Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) Calculated Molecular Weight: 1255 aa, 138 kDa GenBank Accession Number: BC156755 Gene Symbol: HER2/ErbB2 Gene ID (NCBI): 2064 RRID: AB_2881423 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04626 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.