Proteintech, 60320-1-Ig, Cytokeratin 14 Monoclonal antibody

Size: 20ul / 150ul The Cytokeratin 14 (60320-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 14 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 60320-1-Ig targets Cytokeratin 14 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A431 cells, mouse skin tissue Positive IHC detected in: human lung cancer tissue, human cervical cancer tissue, human skin tissue, human breast hyperplasia tissue, human skin cancer tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species Full Name: keratin 14 Calculated Molecular Weight: 472 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC002690 Gene Symbol: Cytokeratin 14 Gene ID (NCBI): 3861 RRID: AB_2881431 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.