Proteintech, 60322-1-Ig, P-selectin / CD62P Monoclonal antibody

Size: 20ul / 150ul The P-selectin / CD62P (60322-1-Ig) by Proteintech is a Monoclonal antibody targeting P-selectin / CD62P in WB, IP, ELISA applications with reactivity to human samples 60322-1-Ig targets P-selectin / CD62P in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets, Jurkat cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information P-selectin, also known as GMP140 or CD62P, is a transmembrane glycoprotein that mediates the interaction of activated endothelial cells or platelets with leukocytes. It is an adhesion molecule involved in the pathogenesis of inflammation, thrombosis, and oncogenesis. P-selectin is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4124 Product name: Recombinant human SELP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 441-789 aa of BC028067 Sequence: VCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQDDGKCPLNPHSHLGTYGVFTNAAFDPSP Predict reactive species Full Name: selectin P (granule membrane protein 140kDa, antigen CD62) Calculated Molecular Weight: 830 aa, 91 kDa Observed Molecular Weight: 140 kDa, 105-110 kDa GenBank Accession Number: BC028067 Gene Symbol: CD62P Gene ID (NCBI): 6403 RRID: AB_2881433 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.