Proteintech, 60326-1-Ig, Bestrophin-1 Monoclonal antibody

Size: 20ul / 150ul The Bestrophin-1 (60326-1-Ig) by Proteintech is a Monoclonal antibody targeting Bestrophin-1 in WB, IF/ICC, ELISA applications with reactivity to human samples 60326-1-Ig targets Bestrophin-1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Y79 cells, Transfected HEK-293 cells Positive IF/ICC detected in: Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Bestrophin-1 (BEST1) is a 68 kDa transmembrane protein which belongs to the bestrophin family of anion channels. It is predominantly expressed in the basolateral membrane of the retinal pigment epithelium. Studies show that bestrophin 1 functions as a Ca(2+)-dependent Cl(-) channel and modulator of voltage-dependent L-type Ca(2+) channels. It may also contribute to the basolateral cell conductance in airway epithelial cells. This protein is encoded by the VMD2 gene. Mutations in VMD2 can lead to different types of retinal or macular degenerations, including Best vitelliform macular dystrophy (BMD), autosomal recessive bestrophinopathy (ARB), autosomal dominant vitreoretinochoroidopathy (ADVIRC) and adult-onset vitelliform macular dystrophy (AVMD). Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15129 Product name: Recombinant human BEST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-498 aa of BC015220 Sequence: ANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS Predict reactive species Full Name: bestrophin 1 Calculated Molecular Weight: 585 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC015220 Gene Symbol: Bestrophin/BEST1 Gene ID (NCBI): 7439 RRID: AB_2881436 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O76090 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.