Iright
BRAND / VENDOR: Proteintech

Proteintech, 60336-1-Ig, BRINP1 Monoclonal antibody

CATALOG NUMBER: 60336-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BRINP1 (60336-1-Ig) by Proteintech is a Monoclonal antibody targeting BRINP1 in WB, IF/ICC, ELISA applications with reactivity to human, pig, mouse samples 60336-1-Ig targets BRINP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, pig, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, pig brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BRINP1, also known as DBC1 and FAM5A, inhibits cell proliferation by negative regulation of the G1/S transition. It mediates cell death which is not of the classical apoptotic type and regulates expression of components of the plasminogen pathway. Specification Tested Reactivity: human, pig, mouse Host / Isotype: Mouse / IgG2c Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6588 Product name: Recombinant human DBC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-306 aa of BC021560 Sequence: MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEAYKDLEN Predict reactive species Full Name: deleted in bladder cancer 1 Calculated Molecular Weight: 761 aa, 88 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC021560 Gene Symbol: BRINP1 Gene ID (NCBI): 1620 RRID: AB_2881445 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60477 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924