Proteintech, 60341-1-Ig, FGF18 Monoclonal antibody

Size: 20ul / 150ul The FGF18 (60341-1-Ig) by Proteintech is a Monoclonal antibody targeting FGF18 in WB, ELISA applications with reactivity to human, mouse, rabbit samples 60341-1-Ig targets FGF18 in WB, ELISA applications and shows reactivity with human, mouse, rabbit samples. Tested Applications Positive WB detected in: HT-1080 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FGF18 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. Specification Tested Reactivity: human, mouse, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2041 Product name: Recombinant human FGF18 protein Source: e coli. -derived, PKG Tag: GST Domain: 1-207 aa of BC006245 Sequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA Predict reactive species Full Name: fibroblast growth factor 18 Calculated Molecular Weight: 207 aa, 24 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC006245 Gene Symbol: FGF18 Gene ID (NCBI): 8817 RRID: AB_2881450 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O76093 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.