Proteintech, 60346-1-Ig, Gastrin Monoclonal antibody

Size: 20ul / 150ul The Gastrin (60346-1-Ig) by Proteintech is a Monoclonal antibody targeting Gastrin in IHC, IF-P, ELISA applications with reactivity to human samples 60346-1-Ig targets Gastrin in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human stomach cancer tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12795 Product name: Recombinant human GAST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-101 aa of BC069724 Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN Predict reactive species Full Name: gastrin Calculated Molecular Weight: 101 aa, 11 kDa GenBank Accession Number: BC069724 Gene Symbol: Gastrin Gene ID (NCBI): 2520 RRID: AB_2881455 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.