Iright
BRAND / VENDOR: Proteintech

Proteintech, 60414-1-Ig, LMOD1 Monoclonal antibody

CATALOG NUMBER: 60414-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMOD1 (60414-1-Ig) by Proteintech is a Monoclonal antibody targeting LMOD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 60414-1-Ig targets LMOD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig colon tissue, ARPE-19 cells, hTERT-RPE1 cells, rabbit colon tissue, rat colon tissue, mouse colon tissue, rabbit testis tissue, rat uterus tissue, mouse uterus tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:1000-1:4000 Background Information LMOD1 was initially identified as a 64-kDa autoantigen in an expression screen with sera from patients with Hashimoto's thyroiditis. Recently immunohistochemistry and immunoblotting of LMOD1 demonstrated its highly restrictive pattern of expression in SMC lineages,like adult aorta, and bladder. LMOD1 is also shown to exhibit an embryonic and adult expression pattern. These data identify LMOD1 as a new SMC-restricted gene associated with the SMC differentiated phenotype. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7568 Product name: Recombinant human LMOD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-269 aa of BC001755 Sequence: MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ Predict reactive species Full Name: leiomodin 1 (smooth muscle) Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC001755 Gene Symbol: LMOD1 Gene ID (NCBI): 25802 RRID: AB_3670257 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P29536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924