Proteintech, 60468-1-Ig, CEP120 Monoclonal antibody

Size: 20ul / 150ul The CEP120 (60468-1-Ig) by Proteintech is a Monoclonal antibody targeting CEP120 in WB, ELISA applications with reactivity to human samples 60468-1-Ig targets CEP120 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, K-562 cells, IMR-32 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CEP120 encodes a protein that functions in the microtubule-dependent coupling of the nucleus and the centrosome. It is involved in regulating centrosome-mediated interkinetic nuclear migration of neural progenitors (PMID: 27185865, 23857771). CEP120, SPICE1, and CPAP are required for centriole elongation and for the recruitment of distal microtubule-capping proteins and CEP135 to procentrioles (PMID: 23810536). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33947 Product name: Recombinant human CEP120 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 85-346 aa of BC040527 Sequence: VTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQ Predict reactive species Full Name: centrosomal protein 120kDa Calculated Molecular Weight: 986 aa, 113 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC040527 Gene Symbol: CEP120 Gene ID (NCBI): 153241 RRID: AB_3670261 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N960 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.