Iright
BRAND / VENDOR: Proteintech

Proteintech, 60487-7-Ig, NARS2 Monoclonal antibody

CATALOG NUMBER: 60487-7-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NARS2 (60487-7-Ig) by Proteintech is a Monoclonal antibody targeting NARS2 in WB, ELISA applications with reactivity to human, mouse, rat samples 60487-7-Ig targets NARS2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, Caco-2 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial) is a nuclear-encoded enzyme that functions within the mitochondria, the energy-producing organelles of the cell. It belongs to the class II family of aminoacyl-tRNA synthetases (aaRSs), a group of essential enzymes responsible for protein synthesis. Its proper function is indispensable for mitochondrial protein synthesis and energy production, and its deficiency underlies a spectrum of severe human metabolic and neurological diseases. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9326 Product name: Recombinant human NARS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 132-477 aa of BC007800 Sequence: ERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLARSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL Predict reactive species Full Name: asparaginyl-tRNA synthetase 2, mitochondrial (putative) Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 50-54 kDa GenBank Accession Number: BC007800 Gene Symbol: NARS2 Gene ID (NCBI): 79731 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96I59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924