Proteintech, 60635-1-Ig, FPGS Monoclonal antibody

Size: 20ul / 150ul The FPGS (60635-1-Ig) by Proteintech is a Monoclonal antibody targeting FPGS in WB, FC (Intra), ELISA applications with reactivity to human samples 60635-1-Ig targets FPGS in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FPGS is located in the cytosol and mitochondria of mammalian tissues, with current evidence supporting a single gene encoding for both the cytosolic and mitochondrial isoenzymes. FPGS catalyzes a rate-limiting polyglutamylation step in the folic acid metabolic pathway and increases the intracellular retention of folates (PMID: 8907263, PMID: 31611592). FPGS has 4 isoforms with the molecular mass of 59-65 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag36736 Product name: Recombinant human FPGS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 236-587 aa of BC064393 Sequence: VEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSVPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ Predict reactive species Full Name: folylpolyglutamate synthase Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC064393 Gene Symbol: FPGS Gene ID (NCBI): 2356 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q05932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.