Proteintech, 60647-1-Ig, IGF2BP2 Monoclonal antibody

Size: 20ul / 150ul The IGF2BP2 (60647-1-Ig) by Proteintech is a Monoclonal antibody targeting IGF2BP2 in WB, ELISA applications with reactivity to human samples 60647-1-Ig targets IGF2BP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HT-1080 cells, A431 cells, HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33681 Product name: Recombinant human IGF2BP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species Full Name: insulin-like growth factor 2 mRNA binding protein 2 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC021290 Gene Symbol: IGF2BP2 Gene ID (NCBI): 10644 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.