Proteintech, 60681-2-Ig, SSTR1 Monoclonal antibody

Size: 20ul / 150ul The SSTR1 (60681-2-Ig) by Proteintech is a Monoclonal antibody targeting SSTR1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 60681-2-Ig targets SSTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig cerebellum tissue, mouse brain tissue, pig brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SSTR1 is a Gi/o-coupled somatostatin receptor expressed in the brain, pancreas, and gastrointestinal epithelium, where it modulates neurotransmission, hormone secretion, and cellular proliferation. Through suppression of cAMP and regulation of Ca²⁺ signaling, SSTR1 mediates key inhibitory actions of somatostatin. Its expression in neuroendocrine tumors and roles in metabolic and neurological regulation underscore its clinical and biological relevance. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30826 Product name: Recombinant human SSTR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 328-391 aa of BC035618 Sequence: DNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL Predict reactive species Full Name: somatostatin receptor 1 Calculated Molecular Weight: 391 aa, 43 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC035618 Gene Symbol: SSTR1 Gene ID (NCBI): 6751 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30872 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.