Iright
BRAND / VENDOR: Proteintech

Proteintech, 60921-3-Ig, RBP3 Monoclonal antibody

CATALOG NUMBER: 60921-3-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RBP3 (60921-3-Ig) by Proteintech is a Monoclonal antibody targeting RBP3 in WB, ELISA applications with reactivity to human, mouse, rat, rabbit samples 60921-3-Ig targets RBP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rat retina tissue, rabbit retina tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6182 Product name: Recombinant human RBP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 898-1247 aa of BC039844 Sequence: AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL Predict reactive species Full Name: retinol binding protein 3, interstitial Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC039844 Gene Symbol: RBP3 Gene ID (NCBI): 5949 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10745 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924