Iright
BRAND / VENDOR: Proteintech

Proteintech, 60934-3-Ig, NRAS Monoclonal antibody

CATALOG NUMBER: 60934-3-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NRAS (60934-3-Ig) by Proteintech is a Monoclonal antibody targeting NRAS in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 60934-3-Ig targets NRAS in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, C6 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29746 Product name: Recombinant human NRAS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-189 aa of BC005219 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Predict reactive species Full Name: neuroblastoma RAS viral (v-ras) oncogene homolog Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005219 Gene Symbol: NRAS Gene ID (NCBI): 4893 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924